PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008798
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 165aa    MW: 18740.3 Da    PI: 8.9017
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58674768PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.2e-3849106259
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k
  Lsa008798  49 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAK 106
                68999***************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2948106IPR003851Zinc finger, Dof-type
PfamPF027014.1E-3251106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.25853107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MADVHKGLDA TGIKLFGKMI NVQAMRELKE EQVCKSEVDD DQSLANKRPD KIIPCPRCKS  60
METKFCYFNN YNVNQPRHFC KGCQRYWTAG GALRNVPVGA GRRKAKPPCG HGAMDDSFSD  120
VSFFEDTTTT SGIHFERMME WHLAAQGSFQ HLFPAKRRRN TTGDF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617825.18e-62PREDICTED: dof zinc finger protein DOF1.5-like
RefseqXP_016448236.18e-62PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotO229672e-51CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A103XTZ61e-106A0A103XTZ6_CYNCS; Zinc finger, Dof-type
STRINGVIT_10s0003g01260.t016e-56(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.19e-51Dof family protein